A collection of tools for Multiple Alignments of DNA, RNA, Protein Sequence

Overview

T-Coffee

T-Coffee is a collection of tools for Computing, Evaluating and Manipulating Multiple Alignments of DNA, RNA, Protein Sequences and Structures.

Prerequisites

T-Coffee compilation requires the following tools installed on your system make, gcc-c++, g77, Perl, sphinx, CPAN.

Compile

Note that the git repository is meant to support the packaging of new releases. If you simply want to install T-Coffee on your system please download the latest distribution from http://www.tcoffee.org/Projects/tcoffee/index.html#DOWNLOAD

All required installation documentation is available from http://www.tcoffee.org/Projects/tcoffee/documentation/index.html#t-coffee-installation

If you nontheless want to compile from git:

Clone the git repository on your computer with the following command: 
	git clone [email protected]:cbcrg/tcoffee.git tcoffee
make sure you have installed all dependencies
cd tcoffee/t_coffee/src
make t_coffee
mv t_coffee <bin location> OR add current dir to your path - not recommended
Comments
  • fmcoffee use 1 core

    fmcoffee use 1 core

    Dears, I am trying to run t_coffe with -mode fmcoffee, but it is not using additional cores. Also I tried t_coffee -in in.fasta -mode fmcoffee -thread 4 -n_core 4 -cpu 4 -multi_core 4 -max_n_proc 4 -outfile out.fasta. None of this flags works for fmcoffee step (kalign, muscle).

    is there other flag to use multithread in fmcoffee mode?.

    thanks in advance, Sandro

    opened by Sanrrone 2
  • Running Expresso on local computer (BLAST_FAILURE)

    Running Expresso on local computer (BLAST_FAILURE)

    Dear tcoffee developers :-)

    I would like to align ~1000 with t-coffee and since the webserver is limited to 150 sequences, I wanted to try on my local computer (MAC OSX11-intel). I installed the beta version since I had issues with the stable one, and actually, I think the issue is similar. So I tested first on 10 sequences and this is the output:

    ✗  t_coffee test.fasta -mode=expresso [email protected]
    
    PROGRAM: T-COFFEE Version_13.45.33.7d7e789 (Version_13.45.33.7d7e789)
    -full_log      	S	[0]
    -genepred_score	S	[0] 	nsd
    -run_name      	S	[0]
    -mem_mode      	S	[0] 	mem
    -extend        	D	[1] 	1
    -extend_mode   	S	[0] 	very_fast_triplet
    -max_n_pair    	D	[0] 	10
    -seq_name_for_quadruplet	S	[0] 	all
    -compact       	S	[0] 	default
    -clean         	S	[0] 	no
    -do_self       	FL	[0] 	0
    -do_normalise  	D	[0] 	1000
    -template_file 	S	[1] 	EXPRESSO
    -setenv        	S	[0] 	0
    -export        	S	[0] 	0
    -template_mode 	S	[0]
    -flip          	D	[0] 	0
    -remove_template_file	D	[0] 	0
    -profile_template_file	S	[1] 	EXPRESSO
    -in            	S	[0]
    -seq           	S	[1] 	test.fasta
    -aln           	S	[0]
    -method_limits 	S	[0]
    -method        	S	[1] 	sap_pair
    -lib           	S	[0]
    -profile       	S	[0]
    -profile1      	S	[0]
    -profile2      	S	[0]
    -pdb           	S	[0]
    -relax_lib     	D	[0] 	1
    -filter_lib    	D	[0] 	0
    -shrink_lib    	D	[0] 	0
    -out_lib       	W_F	[0] 	no
    -out_lib_mode  	S	[0] 	primary
    -lib_only      	D	[0] 	0
    -outseqweight  	W_F	[0] 	no
    -seq_source    	S	[0] 	ANY
    -cosmetic_penalty	D	[0] 	0
    -gapopen       	D	[0] 	0
    -gapext        	D	[0] 	0
    -fgapopen      	D	[0] 	0
    -fgapext       	D	[0] 	0
    -nomatch       	D	[0] 	0
    -newtree       	W_F	[0] 	default
    -tree          	W_F	[0] 	NO
    -usetree       	R_F	[0]
    -tree_mode     	S	[0] 	nj
    -distance_matrix_mode	S	[0] 	ktup
    -distance_matrix_sim_mode	S	[0] 	idmat_sim1
    -quicktree     	FL	[0] 	0
    -outfile       	W_F	[0] 	default
    -maximise      	FL	[1] 	1
    -output        	S	[0] 	aln	html
    -len           	D	[0] 	0
    -infile        	R_F	[0]
    -matrix        	S	[0] 	default
    -tg_mode       	D	[0] 	1
    -profile_mode  	S	[0] 	cw_profile_profile
    -profile_comparison	S	[0] 	profile
    -dp_mode       	S	[0] 	linked_pair_wise
    -ktuple        	D	[0] 	1
    -ndiag         	D	[0] 	0
    -diag_threshold	D	[0] 	0
    -diag_mode     	D	[0] 	0
    -sim_matrix    	S	[0] 	vasiliky
    -transform     	S	[0]
    -extend_seq    	FL	[0] 	0
    -outorder      	S	[0] 	input
    -inorder       	S	[0] 	aligned
    -seqnos        	S	[0] 	off
    -case          	S	[0] 	keep
    -cpu           	D	[0] 	0
    -ulimit        	D	[0] 	-1
    -maxnseq       	D	[0] 	-1
    -maxlen        	D	[0] 	-1
    -sample_dp     	D	[0] 	0
    -weight        	S	[0] 	default
    -seq_weight    	S	[0] 	no
    -align         	FL	[1] 	1
    -mocca         	FL	[0] 	0
    -domain        	FL	[0] 	0
    -start         	D	[0] 	0
    -len           	D	[0] 	0
    -scale         	D	[0] 	0
    -mocca_interactive	FL	[0] 	0
    -method_evaluate_mode	S	[0] 	default
    -color_mode    	S	[0] 	new
    -aln_line_length	D	[0] 	0
    -evaluate_mode 	S	[0] 	triplet
    -get_type      	FL	[0] 	0
    -clean_aln     	D	[0] 	0
    -clean_threshold	D	[1] 	1
    -clean_iteration	D	[1] 	1
    -clean_evaluate_mode	S	[0] 	t_coffee_fast
    -extend_matrix 	FL	[0] 	0
    -prot_min_sim  	D	[0] 	0
    -prot_max_sim  	D	[100] 	100
    -psiJ          	D	[0] 	3
    -psitrim_mode  	S	[0] 	regtrim
    -psitrim_tree  	S	[0] 	codnd
    -psitrim       	D	[100] 	100
    -prot_min_cov  	D	[90] 	90
    -pdb_type      	S	[0] 	d
    -pdb_min_sim   	D	[35] 	35
    -pdb_max_sim   	D	[100] 	100
    -pdb_min_cov   	D	[50] 	50
    -pdb_blast_server	W_F	[0] 	EBI
    -blast         	W_F	[0]
    -blast_server  	W_F	[0] 	EBI
    -pdb_db        	W_F	[0] 	pdb
    -protein_db    	W_F	[0] 	uniref50
    -method_log    	W_F	[0] 	no
    -struc_to_use  	S	[0]
    -cache         	W_F	[0] 	use
    -print_cache   	FL	[0] 	0
    -align_pdb_param_file	W_F	[0] 	no
    -align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
    -external_aligner	S	[0] 	NO
    -msa_mode      	S	[0] 	tree
    -et_mode       	S	[0] 	et
    -master        	S	[0] 	no
    -blast_nseq    	D	[0] 	0
    -lalign_n_top  	D	[0] 	10
    -iterate       	D	[0] 	0
    -trim          	D	[0] 	0
    -split         	D	[0] 	0
    -trimfile      	S	[0] 	default
    -split         	D	[0] 	0
    -split_nseq_thres	D	[0] 	0
    -split_score_thres	D	[0] 	0
    -check_pdb_status	D	[0] 	0
    -clean_seq_name	D	[0] 	0
    -seq_to_keep   	S	[0]
    -dpa_master_aln	S	[0]
    -dpa_maxnseq   	D	[0] 	0
    -dpa_min_score1	D	[0]
    -dpa_min_score2	D	[0]
    -dpa_keep_tmpfile	FL	[0] 	0
    -dpa_debug     	D	[0] 	0
    -multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
    -n_core        	D	[0] 	1
    -thread        	D	[0] 	1
    -max_n_proc    	D	[0] 	1
    -lib_list      	S	[0]
    -prune_lib_mode	S	[0] 	5
    -tip           	S	[0] 	none
    -rna_lib       	S	[0]
    -no_warning    	D	[0] 	0
    -run_local_script	D	[0] 	0
    -proxy         	S	[0] 	unset
    -email         	S	[1] 	[email protected]
    -clean_overaln 	D	[0] 	0
    -overaln_param 	S	[0]
    -overaln_mode  	S	[0]
    -overaln_model 	S	[0]
    -overaln_threshold	D	[0] 	0
    -overaln_target	D	[0] 	0
    -overaln_P1    	D	[0] 	0
    -overaln_P2    	D	[0] 	0
    -overaln_P3    	D	[0] 	0
    -overaln_P4    	D	[0] 	0
    -exon_boundaries	S	[0]
    -display       	D	[0] 	100
    
    INPUT FILES
    	Input File (S) test.fasta  Format fasta_seq
    	Input File (M) sap_pair
    
    Identify Master Sequences [no]:
    
    Master Sequences Identified
    Looking For Sequence Templates:
    
    	Template Type: [EXPRESSO] Mode Or File: [EXPRESSO] [Start
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [1]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [2]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [3]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [4]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output
    80366 -- WARNING: Blast for 1btkA00 failed (Run: 1 out of 2. Use NCBI)
    
    
    *************************************************************************************************
    *                        FULL TRACE BACK PID: 80361
    80366 -- ERROR: BLAST_FAILURE::NCBI does not Support psiblast mode (-j3)
    80366 -- COM: tc_generic_method.pl
    80366 -- STACK: 80361 -> 80366
    *************************************************************************************************
    
    
    *************************************************************************************************
    *                        MESSAGES RECAPITULATION
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [1]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [2]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [3]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output -- will ne tried again [4]
    80366 -- WARNING: [ncbiblast_lwp.pl] [t_coffee -other_pg ncbiblast_lwp.pl --email [email protected] --database pdb --program blastp --outfile outfile --alignments 5 --stype protein seqfile>/dev/null 2>file.3070.32811428769.80366] failed to produce xml output
    80366 -- WARNING: Blast for 1btkA00 failed (Run: 1 out of 2. Use NCBI)
    *************************************************************************************************
    
    # TERMINATION STATUS: FAILURE [PROGRAM: T-COFFEE pid 80361 ppid 80346
    #CL: /var/tmp/tco/tcokytpn68r80346/9752780346th1ii1.pl -other_pg tc_generic_method.pl -mode=pdb_template -database=pdb -method=blastp -cache=/Users/thibault/.t_coffee/cache/ -minid=35 -maxid=100 -mincov=50 -server=EBI -type=_P_ -pdb_type=d -infile=/var/tmp/tco/tcokytpn68r80346/9752780346th1ii134 -outfile=test_pdb1.template_list -tmpdir=/var/tmp/tco/tcokytpn68r80346/
    
    
    *************************************************************************************************
    *                        FULL TRACE BACK PID: 80346
    80361 -- ERROR: UNSPECIFIED UNSPECIFIED
    80361 -- COM: /var/tmp/tco/tcokytpn68r80346/9752780346th1ii1.pl -other_pg tc_generic_method.pl -mode=pdb_template -database=pdb -method=blastp -cache=/Users/thibault/.t_coffee/cache/ -minid=35 -maxid=100 -mincov=50 -server=EBI -type=_P_ -pdb_type=d -infile=/var/tmp/tco/tcokytpn68r80346/9752780346th1ii134 -outfile=test_pdb1.template_list -tmpdir=/var/tmp/tco/tcokytpn68r80346/
    80361 -- STACK: 80346 -> 80361
    *************************************************************************************************
    
    # TERMINATION STATUS: FAILURE [PROGRAM: T-COFFEE pid 80346 ppid 73380
    #CL: t_coffee test.fasta -mode expresso -email [email protected]
    

    Do you know how can I fix this :-) ?

    Best regards, Thibault.

    opened by tubiana 2
  • Unable to use t_coffee on large datasets

    Unable to use t_coffee on large datasets

    I manage to use t_coffee on a fasta with 3 sequences but then I tried with a set of 80 then 200 and both times nothing happens. I tried : t_coffee myseqs.faa and it gets stuck at : "--- Process Method/Library/Aln Mproba_pair"

    t_coffee -quicktree -reg -seq myseqs.faa gets stuck at "!Compute Guide Tree --- "

    opened by lalalagartija 2
  • --ERROR: MAX_N_PID exceded -- Recompile changing the value of MAX_N_PID

    --ERROR: MAX_N_PID exceded -- Recompile changing the value of MAX_N_PID

    t_coffee -version PROGRAM: T-COFFEE Version_13.41.0.28bdc39 (2019-11-30 10:21:53 - Revision 5d5a1c1 - Build 465)

    --ERROR: MAX_N_PID exceded -- Recompile changing the value of MAX_N_PID (current: 260000 Requested: 280441)

    opened by WellJoea 2
  • Error when combining three alignments

    Error when combining three alignments

    Hi,

    I was looking into the bug #917143 inside Debian and tried to reproduce it with the source that you provide from your home page. The failing command is:

    ./t_coffee -aln=../example/sproteases_small.muscle,../example/sproteases_small.tc_aln,../example/sproteases_small.b62_aln -outfile=combined-aln.aln
    

    Here is the stderr of the command: tcoffee.stderr.log

    It seems that there is a bug, but I find it difficult to start tracking it down based on the error message. Interestingly, that with two (not three) input alignments it doesn't fail.

    EDITED: t_coffee.ErrorReport file doesn't get generated for some reason.

    opened by liubovch 1
  • Possible mistakes in if/then syntax

    Possible mistakes in if/then syntax

    Building tcoffee-11.00.8cbe486 on OS X 10.8 with Xcode5.1 (clang compiler) and gcc5 (via fink) for other compilers gives me a bunch of -Wempty-body warnings. They are for code such as:

    dp_lib/evaluate.c:1946:13: warning: if statement has empty body [-Wempty-body]
          if (w);free_int (w, -1);
                ^
    dp_lib/evaluate.c:1946:13: note: put the semicolon on a separate line to silence this warning
    

    It's seeing the first semicolon as the end of the whole if/then, not the end of the "if" clause (that feels like a bash syntax?), which would mean free_int is not in the "then" block. A total of 8 such warnings scattered. Let me know if this is indeed a correct detection of a mistake and I'll pull out the rest from by build logs.

    opened by dmacks 1
  • Spaces in fully qualified path to executable cause t_coffee to fail

    Spaces in fully qualified path to executable cause t_coffee to fail

    If t_coffee is installed in a directory where the path contains a space and the fully qualified path is passed on the command line as such:

    /Applications/Genetic\ Software/t_coffee -infile TCoffeeInput15_Mar_04_15_23_30_1 -outfile TCoffeeOutput15_Mar_04_15_23_30_2 -newtree TCoffeeInput15_Mar_04_15_23_30_1.dnd -output fasta_aln -type PROTEIN -dp_mode myers_miller_pair_wise

    t_coffee fails internally to handle the space in argv[0] with the following error:

    --ERROR: : Software/t_coffee does not exist [FATAL] ************************************************************************************************* * FULL TRACE BACK PID: 68544
    68544 -- ERROR: : Software/t_coffee does not exist [FATAL]

    wontfix 
    opened by nivekkagicom 1
  • t_coffee segmentation fault in biopython test cases

    t_coffee segmentation fault in biopython test cases

    Greetings,

    In the context of the debian project, we noticed that t_coffee version 13.45.0.4846264 is causing a test failure in biopython 1.79. It turns out that the following command:

    $ t_coffee \
            -output clustalw_aln \
            -infile Fasta/fa01 \
            -outfile Fasta/tc_out.aln \
            -type protein \
            -outorder input \
            -gapopen -2 \
            -gapext -5
    

    is causing a segmentation fault when run with the following ./Fasta/fa01 input file:

    >AK1H_ECOLI/1-378
    CPDSINAALICRGEKMSIAIMAGVLEARGH-N--VTVIDPVEKLLAVG-HYLESTVDIAE
    STRRIAASRIP------A-DHMVLMAGFTAGN-EKGELVVLGRNGSDYSAAVLAACLRAD
    CCEIWTDVNGVYTCDP-------------RQVPDARLLKSMSYQEAMELSY--FGAKVLH
    PRTITPIAQFQIPCLIKNTGNPQAPGTL-IG--ASRDEDELP----VKGISNLN------
    NMAMFSVSGP-GMKGMVGMAARVFAAMS-------RARISVVLITQSSSEYSISFCVPQS
    DCVRAERAMLEEFY-----LELKEGLLEPLAVAERLAIISV-VGDGLRTLRGISAKF---
    ---FAALARANINIVAIA
    >AKH_HAEIN/1-382
    -----------------VEDAVKATIDCRGEKLSIAMMKAWFEARGY-S--VHIVDPVKQ
    LLAKG-GYLESSVEIEESTKRVDAANIA--K-DKVVLMAGF---TAGNEKGELVLLGRNG
    SDYSAAC-----------------LAACLGASVCEIWTDVDGVYTCDP--RLVPDARLLP
    TLSYREAMELSYFGAKVIHPRTIGPLLPQNIPCVIKNTGNPSAPGSI-ID--GNVKSESL
    Q----VKGITNLDNLAMFNVSGPGMQGM---VGMASRVFSAMSGAGISVILITQSSSEYS
    ---ISFCVPVKSAEVAKTVLETEFA-----NELNEHQLEPIEVIKDLSIISV-VGDGMKQ
    AKGIAARF------FSALAQAN
    

    Here is a backtrace of the affected portion; the intercepted sequence pointer S is NULL, which is probably the root of the segmentation fault:

    #0  0x0000555555675e73 in seq2unique_name_seq (S=0x0) at util_lib/aln_convertion_util.c:2091
    #1  0x000055555574d656 in read_seq_in_n_list (fname=0x55555598cad0, n=1, type=0x55555593dfb0 "", SeqMode=0x555555d45fb0 "ANY") at util_lib/util_constraints_list.c:2533
    #2  0x0000555555659491 in batch_main (argc=15, argv=0x555555944230) at t_coffee_lib/t_coffee.c:4720
    #3  0x000055555564f9a0 in main (argc=15, argv=0x7fffffffe128) at t_coffee_lib/t_coffee.c:179
    

    You can lookup Debian Bug#1022570 for some further details, but I tried to gather the most relevant information here.

    Have a nice day, :) Étienne.

    opened by emollier 1
  • please do not edit ~/.bashrc, etc on install

    please do not edit ~/.bashrc, etc on install

    just wasted a couple of hours because I had previously installed T-COFFEE and it had edited a bunch of startup files behind my back to add export PERL5LIB=

    Can you please not do this?? There are other ways to set paths for a given program without modifying the behavior other, unrelated programs.

    opened by diekhans 0
  • Stuck at 100% -  tcoffee regressive mode

    Stuck at 100% - tcoffee regressive mode

    First of all, thank you very much for your work and dedication, I really enjoy using the t_coffee suite.

    I am running a multiple alignment of a fasta containing ~7500 sequences with these lengths:

    file     format  type     num_seqs    sum_len  min_len  avg_len  max_len
    1_1.faa  FASTA   Protein     7,582  7,901,142      300  1,042.1   13,093
    

    These are the commands that I'm using:

    t_coffee -other_pg seq_reformat -in 1_1.faa -output code_name > 1_1.code_name
    t_coffee -other_pg seq_reformat -code 1_1.code_name -in 1_1.faa > 1_1.coded.fasta
    t_coffee -reg -seq 1_1.coded.fasta -nseq 750 -tree mbed -method maffteinsi_msa -outfile 1_1.coded.aln -outtree 1_1.coded.mbed -thread 20
    t_coffee -other_pg seq_reformat -decode 1_1.code_name -in 1_1.coded.aln > 1_1.aln
    

    At a certain point, the output remains in this state

    imagen

    In addition, t_coffee remains in process state S (interruptable sleep) consuming ~60GB of RAM. After several days of checking the process, it does not seem to move from there. I have tried restarting the alignment several times but it keeps stopping at the same point.

    Do I have to leave it until it finishes?

    Is it possible to estimate how long it may take? I have aligned other files with slightly smaller sizes a little below and I have not had this kind of problem. Could it be due to the large size difference (from 300aa to >13 000aa) ?

    opened by pentamorfico 0
  • How to set MAX N PID

    How to set MAX N PID

    The max pid is incorrectly set. In previous issues there is a suggestion that max pid can be set as an environment variable, but there is no documentation of what this variable should be anywhere nor what version of t_coffee supports this behavior. When t_coffee complains about the max pid it says to set the variable and recompile, but again there is no indication of how to achieve this. How can we properly set the max pid?

    opened by davidfstein 1
Owner
Notredame Lab
Comparative Bioinformatics, CRG
Notredame Lab
find likely coding segments in DNA using composition-normalised hexamer tables

hextable makes files of statistics that hexamer uses to scan for likely coding regions

Richard Durbin 14 Jan 21, 2022
Repository for building and operating REVOLVER: An automatic protein purification system for gravity columns. Developed at the University of Toronto.

REVOLVER: An automated protein purification system This repository contains all the hardware and firmware files to build and operate REVOLVER: an auto

Laboratory for Metabolic Systems Engineering 3 Jun 14, 2022
The Vulkan Profiles Tools are a collection of tools delivered with the Vulkan SDK for Vulkan application developers to leverage Vulkan Profiles while developing a Vulkan application

Copyright © 2021-2022 LunarG, Inc. Vulkan Profiles Tools (BETA) The Vulkan Profiles Tools are a collection of tools delivered with the Vulkan SDK for

The Khronos Group 71 Nov 13, 2022
R integration for edlib, a C/C++ library for pairwise sequence alignment using edit distance (Levenshtein distance).

edlibR Introduction Main Features Usage Background Alignment Methods Algorithmic Design Installation References edlibR: R integration for edlib The R

null 5 Mar 2, 2022
By putting in a lot of speed, the speed sequence is sorted and divided, three types of speed interval distribution maps are generated.(including broken line graph,histogram and curve graph)

Auto-drawing-speed-range-map By putting in a lot of speed, the speed sequence is sorted and divided, three types of speed interval distribution maps a

wellwellAllwen 4 May 14, 2022
Suckless-tools - My fork of suckless tools.

suckless-tools Here is my fork of suckless tools. I didn't include tabbed, i was using but not actively. I am using xfce4-terminal instead of st. Beca

null 2 Jan 7, 2022
A collection of tools made by the nerds @ axial

Tools created by Nerds @ AXIAL Tool Name: Vichiti Author: 0x9747 Domain: Open-source Intelligence Tool Name: FLAMES Author: Devisha Rochlani Domain: M

AXIAL 16 Oct 31, 2021
sbase is a collection of unix tools that are inherently portable across UNIX and UNIX-like systems.

sbase is a collection of unix tools that are inherently portable across UNIX and UNIX-like systems.

Anton Samokhvalov 1 Nov 1, 2021
A collection of individual tools to randomize bdsp sheets

BDSP_Randomisers A collection of tools to randomize BDSP assets Setup (Windows 10 only) Install Ubuntu 18.04 via WSL1 (plenty of tutorials on that) In

null 6 Mar 1, 2022
An open collection of tools and experiments for rendering wide-gamut scene-linear data into an image for an SDR or HDR display device.

Open Display Transform An open collection of tools and experiments for rendering wide-gamut scene-linear data into an image for an SDR or HDR display

Jed Smith 123 Nov 14, 2022
Collection of tools to manage Teensy boards

You can find these instructions on the official web page. Overview TyTools is a collection of independent tools and you only need one executable to us

Niels Martignène 180 Nov 14, 2022
A collection of command line tools for ARM devices with Allwinner SoCs.

sunxi-tools Copyright (C) 2012 Alejandro Mery [email protected] For a full list of contributors, see this link or use the command git shortlog -se --no-m

Free/Open Source Software for Allwinner SoCs (A10/A13/A10s/A20/A31/...) 457 Nov 14, 2022
A Visual Studio extension containing a collection of tools to help contributing code to the Chromium project.

VsChromium VsChromium is a Visual Studio Extension containing a collection of tools useful for editing, navigating and debugging code. VsChromium was

The Chromium Project 258 Nov 17, 2022
A collection of tools, libraries, and tests for Vulkan shader compilation.

Shaderc A collection of tools, libraries and tests for shader compilation. At the moment it includes: glslc, a command line compiler for GLSL/HLSL to

Google 1.4k Nov 7, 2022
A personal collection of Windows CVE I have turned in to exploit source, as well as a collection of payloads I've written to be used in conjunction with these exploits.

This repository contains a personal collection of Windows CVE I have turned in to exploit source, as well as a collection of payloads I've written to

null 81 Nov 11, 2022
image_projection is a ROS package to create various projections from multiple calibrated cameras.

image_projection Overview image_projection is a ROS package to create various projections from multiple calibrated cameras. Use cases involve: Rectify

Technische Universität Darmstadt ROS Packages 117 Nov 13, 2022
Allows for multiple SwitchBot buttons and curtains to be controlled via MQTT sent to ESP32. ESP32 will send BLE commands to switchbots and return MQTT responses to the broker. Also supports Meter/Temp Sensor

SwitchBot-MQTT-BLE-ESP32 Switchbot local control using ESP32. no switchbot hub used/required. works with any smarthub that supports MQTT https://githu

null 326 Nov 15, 2022
Provenance - An iOS & tvOS Frontend for Multiple Emulators

iOS & tvOS multi-emulator frontend, supporting various Atari, Bandai, NEC, Nintendo, Sega, SNK and Sony console systems…

Provenance Emu 5k Nov 17, 2022
Samir Teymurov 1 Oct 6, 2021